PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2BS_D435A8999.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family WRKY
Protein Properties Length: 524aa    MW: 57031.1 Da    PI: 6.8274
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2BS_D435A8999.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY99.81.7e-31141198260
                            --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
                   WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                            dDgynWrKYGqK+vkgse+prsYY+Ct+++C+vkk +er+  d+ ++e++Y+g+Hnh+k
  Traes_2BS_D435A8999.1 141 DDGYNWRKYGQKHVKGSENPRSYYKCTHPNCEVKKLLERAV-DGLITEVVYKGRHNHPK 198
                            8****************************************.***************85 PP

2WRKY107.66.2e-34313371159
                            ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                   WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                            ldDgy+WrKYGqK+vkg+++prsYY+Cts+gCpv+k+ver+++dpk v++tYeg+Hnhe
  Traes_2BS_D435A8999.1 313 LDDGYRWRKYGQKVVKGNPNPRSYYKCTSTGCPVRKHVERASHDPKSVITTYEGKHNHE 371
                            59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.5E-27133199IPR003657WRKY domain
PROSITE profilePS5081123.525135199IPR003657WRKY domain
SuperFamilySSF1182901.83E-24139199IPR003657WRKY domain
SMARTSM007747.1E-35140198IPR003657WRKY domain
PfamPF031063.8E-24141197IPR003657WRKY domain
Gene3DG3DSA:2.20.25.805.0E-38298373IPR003657WRKY domain
SuperFamilySSF1182909.68E-30305373IPR003657WRKY domain
PROSITE profilePS5081138.871308373IPR003657WRKY domain
SMARTSM007741.4E-39313372IPR003657WRKY domain
PfamPF031061.7E-26314371IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 524 aa     Download sequence    Send to blast
MAAIMHKSAH PDILPSPRDK SIRAHEDGGS RDFEFKPHLN SSSQSLAPAM SDLKKHEHSM  60
QNQSMNPSSS SSNMVNENRP PCSRESSLTV NVSAPNQPVG MVGLTDNMPA EVGTSEPQQM  120
NSSDNAMQEP QSENVADKSA DDGYNWRKYG QKHVKGSENP RSYYKCTHPN CEVKKLLERA  180
VDGLITEVVY KGRHNHPKPQ PNRRLAGGAV PSNQGEERYD GAAAADDKSS NALSNLANPV  240
NSPGMVEPVP VSVSDDDIDA GGGRPYPGDD ATEEDLESKR RKMESAGIDA ALMGKPNREP  300
RVVVQTVSEV DILDDGYRWR KYGQKVVKGN PNPRSYYKCT STGCPVRKHV ERASHDPKSV  360
ITTYEGKHNH EVPAARNATH EMSAPPMKNV VHQINSSMPS SIGGMMRACE ARNFSNQYSQ  420
AAETDNVSLD LGVGISPNHS DATNQMQSSG PDQMQYQMQS MASMYGNMRH PSSMAVPTVQ  480
GNSAGRMYGS REEKGNEGFT FRATPMDHSA NLCYSGAGNL VMGP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-37141374878Probable WRKY transcription factor 4
2lex_A2e-37141374878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0094300.0BT009430.1 Triticum aestivum clone wlmk1.pk0035.d9:fis, full insert mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003562812.10.0PREDICTED: WRKY transcription factor SUSIBA2
SwissprotQ6VWJ60.0WRK46_HORVU; WRKY transcription factor SUSIBA2
TrEMBLW5BP380.0W5BP38_WHEAT; Uncharacterized protein
STRINGBRADI1G23340.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP67403851
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.11e-104WRKY family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]